PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G268700.1.p
Common NameSETIT_019625mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 298aa    MW: 32426.2 Da    PI: 10.6028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G268700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-321972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWt+eLH++Fv+av+ LGG++kAtPk il+lm+v gLt++hvkSHLQ+YR+
  Seita.1G268700.1.p 19 PRLRWTSELHRSFVRAVDCLGGQDKATPKLILQLMDVRGLTIAHVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4691575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-301573IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-231972IPR006447Myb domain, plants
SuperFamilySSF466895.73E-161972IPR009057Homeodomain-like
PfamPF002491.5E-62071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGGAGGATTR RRYNRSTVPR LRWTSELHRS FVRAVDCLGG QDKATPKLIL QLMDVRGLTI  60
AHVKSHLQMY RSSGHDIRKT EMQPRLGHLK HSFTVDEGGP KEFICPPMKR AKAGAATVTH  120
ESMQGNSDMG APGTRRCGDD YTQAVPVGCS RRITECLRWQ WQRDAAAAST LQELGFWVRG  180
TEPFKVRQIG RPIANRFSPV VRQLSSKEIK CENRCFLFGT ATRDEAAKKL SPLRPLGSID  240
PKAAVAAVSS WPREGSCVLS PPPSSTSFSG CSGPGRGSCL FAGQRINLDL SLSICGS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955145.10.0PREDICTED: uncharacterized protein LOC101762085
TrEMBLK3YZB70.0K3YZB7_SETIT; Uncharacterized protein
STRINGSi019625m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-28G2-like family protein